TA333388 FAM131C antibody

Rabbit Polyclonal Anti-FAM131C Antibody

See related secondary antibodies

Search for all "FAM131C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish FAM131C

Product Description for FAM131C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish FAM131C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM131C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf117
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AQ9
Immunogen:
The immunogen for Anti-FAM131C Antibody: synthetic peptide directed towards the middle region of human FAM131C. Synthetic peptide located within the following region: RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF.
GeneID:
348487
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM131C (1 products)

Catalog No. Species Pres. Purity   Source  

FAM131C (N-term HIS tag)

FAM131C Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for FAM131C (1 products)

Catalog No. Species Pres. Purity   Source  

FAM131C overexpression lysate

FAM131C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn