TA333390 MAMSTR antibody

Rabbit Polyclonal Anti-FLJ36070 Antibody

See related secondary antibodies

Search for all "MAMSTR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MAMSTR

Product Description for MAMSTR

Rabbit anti Human MAMSTR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAMSTR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MASTR, MEF2-activating SAP transcriptional regulatory protein, MEF2-activating motif and SAP domain-containing transcriptional regulator
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZN01
Immunogen:
The immunogen for Anti-FLJ36070 Antibody: synthetic peptide directed towards the N terminal of human FLJ36070. Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR.
GeneID:
284358
Application WB
Background FLJ36070 is a transcriptiol coactivator.FLJ36070 stimulates the transcriptiol activity of MEF2C. FLJ36070 stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn