TA333396 TMPRSS12 antibody

Rabbit Polyclonal Anti-TMPRSS12 Antibody

See related secondary antibodies

Search for all "TMPRSS12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Rabbit TMPRSS12

Product Description for TMPRSS12

Rabbit anti Guinea Pig, Human, Rabbit TMPRSS12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMPRSS12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protease serine 12
Presentation Purified
Reactivity GP, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WS5
Immunogen:
The immunogen for Anti-TMPRSS12 Antibody: synthetic peptide directed towards the middle region of human TMPRSS12. Synthetic peptide located within the following region: KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC.
GeneID:
283471
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMPRSS12 (1 products)

Catalog No. Species Pres. Purity   Source  

TMPRSS12 overexpression lysate

TMPRSS12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn