TA333399 MLCK antibody

Rabbit Polyclonal Anti-MYLK3 Antibody

See related secondary antibodies

Search for all "MLCK"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human MLCK

Product Description for MLCK

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human MLCK.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLCK

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MYLK3, Putative myosin light chain kinase 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q32MK0
Immunogen:
The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK.
GeneID:
91807
Application WB
Background Phosphorylation of cardiac myosin heavy chains and light chains by a kise, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MLCK (2 products)

Catalog No. Species Pres. Purity   Source  

MLCK

MLCK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MLCK

MLCK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MLCK (1 products)

Catalog No. Species Pres. Purity   Source  

MYLK3 overexpression lysate

MYLK3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn