TA333416 Serine incorporator 2 / SERINC2 antibody

Rabbit Polyclonal Anti-SERINC2 Antibody

See related secondary antibodies

Search for all "Serine incorporator 2 / SERINC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Serine incorporator 2 / SERINC2

Product Description for Serine incorporator 2 / SERINC2

Rabbit anti Human Serine incorporator 2 / SERINC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Serine incorporator 2 / SERINC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TDE2L, Tumor differentially expressed protein 2-like
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96SA4
Immunogen:
The immunogen for Anti-SERINC2 Antibody: synthetic peptide directed towards the N terminal of human SERINC2. Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS.
GeneID:
347735
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn