TA333439 CASC4 antibody

Rabbit Polyclonal Anti-CASC4 Antibody

See related secondary antibodies

Search for all "CASC4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse CASC4

Product Description for CASC4

Rabbit anti Human, Mouse CASC4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CASC4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cancer susceptibility candidate gene 4 protein
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P4E1
Immunogen:
The immunogen for Anti-CASC4 Antibody is: synthetic peptide directed towards the middle region of Human CASC4. Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV.
GeneID:
113201
Application WB
Background The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Altertively spliced variants encoding different isoforms have been identified for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CASC4 (2 products)

Catalog No. Species Pres. Purity   Source  

CASC4

CASC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CASC4

CASC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CASC4 (1 products)

Catalog No. Species Pres. Purity   Source  

CASC4 overexpression lysate

CASC4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn