TA333452 RNF151 antibody

Rabbit Polyclonal Anti-RNF151 Antibody

See related secondary antibodies

Search for all "RNF151"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat RNF151

Product Description for RNF151

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat RNF151.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF151

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 151
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2KHN1
Immunogen:
The immunogen for Anti-RNF151 Antibody is: synthetic peptide directed towards the middle region of Human RNF151. Synthetic peptide located within the following region: AHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGC.
GeneID:
146310
Application WB
Background RNF151 may be involved in acrosome formation of spermatids.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF151 (4 products)

Catalog No. Species Pres. Purity   Source  

RNF151

RNF151 Human Purified
  Abnova Taiwan Corp.

RNF151

RNF151 Human Purified
  Abnova Taiwan Corp.

RNF151

RNF151 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF151

RNF151 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF151 (2 products)

Catalog No. Species Pres. Purity   Source  

RNF151 293T Cell Transient Overexpression Lysate(Denatured)

RNF151 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNF151 overexpression lysate

RNF151 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn