Max-like protein X - TA333463 | acris-antibodies.com

Product Description for Max-like protein X

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat Max-like protein X.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Max-like protein X

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	BigMax protein, MLX, Max-like bHLHZip protein, TCFL4, Transcription factor-like protein 4
Presentation	Purified
Reactivity	Bov, Can, Eq, Gt, Hu, Ms, Por, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q9UH92 Immunogen: The immunogen for Anti-MLX Antibody: synthetic peptide directed towards the C terminal of human MLX. Synthetic peptide located within the following region: LRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF. GeneID: 6945
Application	WB
Background	MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determition and differentiation. MLX may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptiol repressors, mely, Mad1 and Mad4.The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determition and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptiol repressors, mely, Mad1 and Mad4. Altertively spliced transcript variants encoding different isoforms have been identified for this gene.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Max-like protein X (11 products)

Catalog No.	Species	Pres.	Purity	Source
TP301911	Max-like protein X (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP323064	Max-like protein X (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00006945-P01-02	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-P01-10	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-P01-25	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-P02	Max-like protein X
	Human	Purified
					Abnova Taiwan Corp.
H00006945-P02-02	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-P02-10	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-P02-25	Max-like protein X
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006945-Q01-10	Max-like protein X
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00006945-Q01-25	Max-like protein X
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.

Positive controls for Max-like protein X (7 products)

Catalog No.	Species
H00006945-T02	MLX 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-13141	MLX Lysate

		Novus Biologicals Inc.
LY404977	MLX overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY404978	MLX overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY406915	MLX overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY430300	MLX overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.
LY430720	MLX overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for Max-like protein X (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH