TA333484 SLC44A3 / CTL3 antibody

Rabbit Polyclonal Anti-SLC44A3 Antibody

See related secondary antibodies

Search for all "SLC44A3 / CTL3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC44A3 / CTL3

Product Description for SLC44A3 / CTL3

Rabbit anti Human SLC44A3 / CTL3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC44A3 / CTL3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Choline transporter-like protein 3, Solute carrier family 44 member 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4M1-2
Immunogen:
The immunogen for Anti-SLC44A3 Antibody: synthetic peptide directed towards the N terminal of human SLC44A3. Synthetic peptide located within the following region: MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM.
GeneID:
126969
Application WB
Background SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn