TA333488 SLC36A4 / PAT4 antibody

Rabbit Polyclonal Anti-Slc36a4 Antibody

See related secondary antibodies

Search for all "SLC36A4 / PAT4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC36A4 / PAT4

Product Description for SLC36A4 / PAT4

Rabbit anti Human SLC36A4 / PAT4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC36A4 / PAT4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Proton-coupled amino acid transporter 4, Solute carrier family 36 member 4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6YBV0
Immunogen:
The immunogen for Anti-Slc36a4 Antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Slc36a4. Synthetic peptide located within the following region: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI.
GeneID:
120103
Application WB
Background Slc36a4 functions as a sodium-independent electroneutral transporter for tryptophan, proline and alanine.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn