TA333492 ACOT11 / BFIT antibody

Rabbit Polyclonal Anti-ACOT11 Antibody

See related secondary antibodies

Search for all "ACOT11 / BFIT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ACOT11 / BFIT

Product Description for ACOT11 / BFIT

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ACOT11 / BFIT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACOT11 / BFIT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-CoA thioester hydrolase 11, Acyl-CoA thioesterase 11, Acyl-coenzyme A thioesterase 11, Adipose-associated thioesterase, Brown fat-inducible thioesterase, KIAA0707, THEA
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WXI4
Immunogen:
The immunogen for Anti-ACOT11 Antibody: synthetic peptide directed towards the middle region of human ACOT11. Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL.
GeneID:
26027
Application WB
Background ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACOT11 / BFIT (4 products)

Catalog No. Species Pres. Purity   Source  

ACOT11 / BFIT (19-250, His-tag)

ACOT11 / BFIT Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ACOT11 / BFIT (19-250, His-tag)

ACOT11 / BFIT Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ACOT11 / BFIT

ACOT11 / BFIT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACOT11 / BFIT

ACOT11 / BFIT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ACOT11 / BFIT (2 products)

Catalog No. Species Pres. Purity   Source  

ACOT11 overexpression lysate

ACOT11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ACOT11 overexpression lysate

ACOT11 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn