TA333528 ALKBH3 / DEPC1 antibody

Rabbit Polyclonal Anti-ALKBH3 Antibody

See related secondary antibodies

Search for all "ALKBH3 / DEPC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ALKBH3 / DEPC1

Product Description for ALKBH3 / DEPC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ALKBH3 / DEPC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALKBH3 / DEPC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ABH3, Alkylated DNA repair protein alkB homolog 3, Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, Prostate cancer antigen 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96Q83
Immunogen:
The immunogen for Anti-ALKBH3 Antibody: synthetic peptide directed towards the middle region of human ALKBH3. Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS.
GeneID:
221120
Application WB
Background The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific D lesions generated in single-stranded D. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific D lesions generated in single-stranded D. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1519 AB042029.1 2-1520
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALKBH3 / DEPC1 (7 products)

Catalog No. Species Pres. Purity   Source  

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALKBH3 / DEPC1 (1-286, His-tag)

ALKBH3 / DEPC1 Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ALKBH3 / DEPC1 (1-286, His-tag)

ALKBH3 / DEPC1 Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human Purified
  Novus Biologicals Inc.

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human Purified
  Novus Biologicals Inc.

Positive controls for ALKBH3 / DEPC1 (2 products)

Catalog No. Species Pres. Purity   Source  

ALKBH3 293T Cell Transient Overexpression Lysate(Denatured)

ALKBH3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ALKBH3 Lysate

Western Blot: ALKBH3 Lysate [NBL1-07474] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALKBH3 Protein
  Novus Biologicals Inc.
  • LinkedIn