TA333532 GINM1 antibody

Rabbit Polyclonal Anti-GINM1 Antibody

See related secondary antibodies

Search for all "GINM1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GINM1

Product Description for GINM1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GINM1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GINM1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf72, Glycoprotein integral membrane protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NU53
Immunogen:
The immunogen for Anti-GINM1 Antibody is: synthetic peptide directed towards the middle region of Human GINM1. Synthetic peptide located within the following region: SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG.
GeneID:
116254
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GINM1 (1 products)

Catalog No. Species Pres. Purity   Source  

GINM1

GINM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for GINM1 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf72 Lysate

Western Blot: C6orf72 Lysate [NBL1-08538] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf72
  Novus Biologicals Inc.

GINM1 overexpression lysate

GINM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn