TA333535 SLC25A46 / TB1 antibody

Rabbit Polyclonal Anti-SLC25A46 Antibody

See related secondary antibodies

Search for all "SLC25A46 / TB1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC25A46 / TB1

Product Description for SLC25A46 / TB1

Rabbit anti Human SLC25A46 / TB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A46 / TB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Solute carrier family 25 member 46
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AG3
Immunogen:
The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the N terminal of human SLC25A46. Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP.
GeneID:
91137
Application WB
Background SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC25A46 / TB1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC25A46 / TB1

SLC25A46 / TB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SLC25A46 / TB1

SLC25A46 / TB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SLC25A46 / TB1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC25A46 Lysate

Western Blot: SLC25A46 Lysate [NBL1-16072] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC25A46
  Novus Biologicals Inc.

SLC25A46 overexpression lysate

SLC25A46 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn