TA333541 MLIP antibody

Rabbit Polyclonal Anti-MLIP Antibody

See related secondary antibodies

Search for all "MLIP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rat MLIP

Product Description for MLIP

Rabbit anti Canine, Equine, Human, Mouse, Rat MLIP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLIP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf142, Muscular LMNA-interacting protein, Muscular-enriched A-type laminin-interacting protein
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VWP3
Immunogen:
The immunogen for Anti-MLIP Antibody is: synthetic peptide directed towards the N-terminal region of Human MLIP. Synthetic peptide located within the following region: VPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGS.
GeneID:
90523
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MLIP (1 products)

Catalog No. Species Pres. Purity   Source  

MLIP

MLIP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for MLIP (1 products)

Catalog No. Species Pres. Purity   Source  

MLIP overexpression lysate

MLIP overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn