TA333547 RAD51 antibody

Rabbit Polyclonal Anti-RAD51 Antibody

See related secondary antibodies

Search for all "RAD51"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish RAD51

TA333547

More Views

  • TA333547
  • TA333547

Product Description for RAD51

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish RAD51.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RAD51

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA repair protein RAD51 homolog 1, RAD51A, RECA
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06609
Immunogen:
The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS.
GeneID:
5888
Application WB
IHC
Background RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombition and repair of D. This protein can interact with the ssD-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of D. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to D damage. BRCA2 is shown to regulate both the intracellular localization and D-binding ability of this protein. Loss of these controls following BRCA2 ictivation may be a key event leading to genomic instability and tumorigenesis. Two altertively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing altertive polyA sigls exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombition and repair of D. This protein can interact with the ssD-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of D. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to D damage. BRCA2 is shown to regulate both the intracellular localization and D-binding ability of this protein. Loss of these controls following BRCA2 ictivation may be a key event leading to genomic instability and tumorigenesis. Two altertively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing altertive polyA sigls exist.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAD51 (4 products)

Catalog No. Species Pres. Purity   Source  

RAD51 (transcript variant 1)

RAD51 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAD51

RAD51 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAD51

RAD51 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAD51

RAD51 Human > 95 % E. coli
  Funakoshi Co., Ltd.

Positive controls for RAD51 (7 products)

Catalog No. Species Pres. Purity   Source  

RAD51 293T Cell Transient Overexpression Lysate(Denatured)

RAD51 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Rad51 Lysate

Western Blot: Rad51 Lysate [NBL1-15117] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAD51
  Novus Biologicals Inc.

RAD51 overexpression lysate

RAD51 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RAD51 overexpression lysate

RAD51 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RAD51 overexpression lysate

RAD51 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

RAD51 overexpression lysate

RAD51 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

RAD51 overexpression lysate

RAD51 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn