TA333565 C20orf96 antibody

Rabbit Polyclonal Anti-C20orf96 Antibody

See related secondary antibodies

Search for all "C20orf96"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human C20orf96

Product Description for C20orf96

Rabbit anti Bovine, Canine, Human C20orf96.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C20orf96

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUD7
Immunogen:
The immunogen for Anti-C20orf96 Antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf96. Synthetic peptide located within the following region: SIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVF.
GeneID:
140680
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf96 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf96 (N-term HIS tag, transcript variant 1)

C20orf96 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for C20orf96 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf96 overexpression lysate

C20orf96 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn