TA333578 MYL12B antibody

Rabbit Polyclonal Anti-MYL12B Antibody

See related secondary antibodies

Search for all "MYL12B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MYL12B

Product Description for MYL12B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MYL12B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYL12B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MLC-2, MLC-2A, MLC20, MRLC2, MYLC2B, Myosin regulatory light chain 2-B, Myosin regulatory light chain 20 kDa, Myosin regulatory light chain MRLC2, SHUJUN-1, smooth muscle isoform
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14950
Immunogen:
The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE.
GeneID:
103910
Application WB
Background The activity of nonmuscle myosin II is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYL12B (7 products)

Catalog No. Species Pres. Purity   Source  

MYL12B (transcript variant 2)

MYL12B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MYL12B (1-172, His-tag)

MYL12B Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MYL12B (1-172, His-tag)

MYL12B Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MYL12B

MYL12B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYL12B

MYL12B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYL12B

MYL12B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYL12B

MYL12B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MYL12B (3 products)

Catalog No. Species Pres. Purity   Source  

MRLC2 Lysate

Western Blot: MRLC2 Lysate [NBL1-13229] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYL12B
  Novus Biologicals Inc.

MYL12B overexpression lysate

MYL12B overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

MYL12B overexpression lysate

MYL12B overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn