TA333610 C22orf23 antibody

Rabbit Polyclonal Anti-C22orf23 Antibody

See related secondary antibodies

Search for all "C22orf23"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C22orf23

Product Description for C22orf23

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C22orf23.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C22orf23

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0193 protein EVG1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZE7
Immunogen:
The immunogen for Anti-C22orf23 Antibody is: synthetic peptide directed towards the middle region of Human C22orf23. Synthetic peptide located within the following region: ILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDM.
GeneID:
84645
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C22orf23 (3 products)

Catalog No. Species Pres. Purity   Source  

C22orf23

C22orf23 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C22orf23

C22orf23 Human Purified
  Abnova Taiwan Corp.

C22orf23

C22orf23 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn