TA333614 C16orf13 antibody

Rabbit Polyclonal Anti-C16orf13 Antibody

See related secondary antibodies

Search for all "C16orf13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C16orf13

Product Description for C16orf13

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C16orf13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C16orf13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0585 protein C16orf13
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96S19
Immunogen:
The immunogen for Anti-C16orf13 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf13. Synthetic peptide located within the following region: PLAEWQPSDVDQRCLDSIAATTQAQGLTNVKAPLHLDVTWGWEHWGGILP.
GeneID:
84326
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C16orf13 (2 products)

Catalog No. Species Pres. Purity   Source  

C16orf13 (transcript variant 3)

C16orf13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C16orf13 (transcript variant 1)

C16orf13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C16orf13 (4 products)

Catalog No. Species Pres. Purity   Source  

C16orf13 Lysate

Western Blot: C16orf13 Lysate [NBL1-08209] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C16orf13 Protein
  Novus Biologicals Inc.

C16orf13 overexpression lysate

C16orf13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

C16orf13 overexpression lysate

C16orf13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

C16orf13 overexpression lysate

C16orf13 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn