TA333617 UQCC2 / MNF1 antibody

Rabbit Polyclonal Anti-MNF1 Antibody

See related secondary antibodies

Search for all "UQCC2 / MNF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat UQCC2 / MNF1

Product Description for UQCC2 / MNF1

Rabbit anti Human, Mouse, Rat UQCC2 / MNF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UQCC2 / MNF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Breast cancer-associated protein SGA-81M, C6orf125, Mitochondrial nucleoid factor 1, Mitochondrial protein M19, Ubiquinol-cytochrome-c reductase complex assembly factor 2
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRT2
Immunogen:
The immunogen for Anti-MNF1 Antibody is: synthetic peptide directed towards the C-terminal region of Human MNF1. Synthetic peptide located within the following region: DTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA.
GeneID:
84300
Application WB
Background This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UQCC2 / MNF1 (1 products)

Catalog No. Species Pres. Purity   Source  

UQCC2 / MNF1

UQCC2 / MNF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for UQCC2 / MNF1 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf125 Lysate

Western Blot: C6orf125 Lysate [NBL1-08511] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf125 Protein
  Novus Biologicals Inc.

UQCC2 overexpression lysate

UQCC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn