TA333632 TTC25 antibody

Rabbit Polyclonal Anti-TTC25 Antibody

See related secondary antibodies

Search for all "TTC25"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TTC25

Product Description for TTC25

Rabbit anti Human TTC25.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TPR repeat protein 25, Tetratricopeptide repeat protein 25
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NG3
Immunogen:
The immunogen for Anti-TTC25 Antibody is: synthetic peptide directed towards the C-terminal region of Human TTC25. Synthetic peptide located within the following region: RLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEY.
GeneID:
83538
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC25 (1 products)

Catalog No. Species Pres. Purity   Source  

TTC25

TTC25 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TTC25 (2 products)

Catalog No. Species Pres. Purity   Source  

TTC25 Lysate

Western Blot: TTC25 Lysate [NBL1-17402] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TTC25
  Novus Biologicals Inc.

TTC25 overexpression lysate

TTC25 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn