TA333635 MRPS15 antibody

Rabbit Polyclonal Anti-MRPS15 Antibody

See related secondary antibodies

Search for all "MRPS15"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MRPS15

TA333635

More Views

  • TA333635
  • TA333635

Product Description for MRPS15

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MRPS15.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MRPS15

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 28S ribosomal protein S15, DC37, RPMS15, S15mt, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P82914
Immunogen:
The immunogen for Anti-MRPS15 Antibody: synthetic peptide directed towards the N terminal of human MRPS15. Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK.
GeneID:
64960
Application WB
IHC
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rR composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rR. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rR binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPS15 (1 products)

Catalog No. Species Pres. Purity   Source  

MRPS15 (full length, N-term HIS tag)

MRPS15 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for MRPS15 (1 products)

Catalog No. Species Pres. Purity   Source  

MRPS15 Lysate

Western Blot: MRPS15 Lysate [NBL1-13287] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MRPS15
  Novus Biologicals Inc.
  • LinkedIn