TA333641 SLC25A32 antibody

Rabbit Polyclonal Anti-SLC25A32 Antibody

See related secondary antibodies

Search for all "SLC25A32"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC25A32

Product Description for SLC25A32

Rabbit anti Human SLC25A32.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A32

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MFT, MFTC, Mitochondrial folate transporter/carrier, Solute carrier family 25 member 32
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2D1
Immunogen:
The immunogen for Anti-SLC25A32 Antibody: synthetic peptide directed towards the middle region of human SLC25A32. Synthetic peptide located within the following region: NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID.
GeneID:
81034
Application WB
Background SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria (Titus and Moran, 2000 [PubMed 10978331]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC25A32 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC25A32 Lysate

Western Blot: SLC25A32 Lysate [NBL1-16061] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC25A32
  Novus Biologicals Inc.
  • LinkedIn