TA333662 CBLL1 / RNF188 antibody

Rabbit Polyclonal Anti-CBLL1 Antibody

See related secondary antibodies

Search for all "CBLL1 / RNF188"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CBLL1 / RNF188

Product Description for CBLL1 / RNF188

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CBLL1 / RNF188.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBLL1 / RNF188

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Casitas B-lineage lymphoma-transforming sequence-like protein 1, E3 ubiquitin-protein ligase Hakai, HAKAI, RING finger protein 188, c-Cbl-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q75N03
Immunogen:
The immunogen for Anti-CBLL1 Antibody: synthetic peptide directed towards the N terminal of human CBLL1. Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR.
GeneID:
79872
Application WB
Background Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitition of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitition of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitition of the CDH1 complex.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CBLL1 / RNF188 (2 products)

Catalog No. Species Pres. Purity   Source  

CBLL1 / RNF188

CBLL1 / RNF188 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CBLL1 / RNF188

CBLL1 / RNF188 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CBLL1 / RNF188 (1 products)

Catalog No. Species Pres. Purity   Source  

CBLL1 overexpression lysate

CBLL1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn