TA333701 ZNF574 antibody

Rabbit Polyclonal Anti-ZNF574 Antibody

See related secondary antibodies

Search for all "ZNF574"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ZNF574

Product Description for ZNF574

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ZNF574.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF574

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 574
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZN55
Immunogen:
The immunogen for Anti-ZNF574 Antibody: synthetic peptide directed towards the C terminal of human ZNF574. Synthetic peptide located within the following region: ATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAA.
GeneID:
64763
Application WB
Background ZNF574 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF574 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF574

ZNF574 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF574

ZNF574 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF574 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF574 293T Cell Transient Overexpression Lysate(Denatured)

ZNF574 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn