TA333708 PKNOX2 antibody

Rabbit Polyclonal Anti-PKNOX2 Antibody

See related secondary antibodies

Search for all "PKNOX2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit PKNOX2

Product Description for PKNOX2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit PKNOX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PKNOX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein PKNOX2, PBX/knotted homeobox 2, PREP-2, PREP2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KN3
Immunogen:
The immunogen for Anti-PKNOX2 Antibody: synthetic peptide directed towards the N terminal of human PKNOX2. Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ.
GeneID:
63876
Application WB
Background PKNOX2 is a TALE homeodomain protein that shows distinct homology with PKNOX1. It may interact with PBX proteins and play a tissue-specific regulation of transcription.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PKNOX2 (4 products)

Catalog No. Species Pres. Purity   Source  

PKNOX2

PKNOX2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

PKNOX2

PKNOX2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

PKNOX2

PKNOX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PKNOX2

PKNOX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PKNOX2 (2 products)

Catalog No. Species Pres. Purity   Source  

PKNOX2 293T Cell Transient Overexpression Lysate(Denatured)

PKNOX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PKNOX2 overexpression lysate

PKNOX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn