TA333712 ZNF6 antibody

Rabbit Polyclonal Anti-ZNF711 Antibody

See related secondary antibodies

Search for all "ZNF6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ZNF6

Product Description for ZNF6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ZNF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CMPX1, ZNF711, Zinc finger protein 6, Zinc finger protein 711
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y462
Immunogen:
The immunogen for Anti-ZNF711 Antibody: synthetic peptide directed towards the N terminal of human ZNF711. Synthetic peptide located within the following region: LEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEI.
GeneID:
7552
Application WB
Background ZNF711 may be involved in transcriptiol regulation.This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptiol activator. This gene lies in a region of the X chromosome which has been associated with mental retardation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn