TA333713 HSPA2 antibody

Rabbit Polyclonal Anti-HSPA2 Antibody

See related secondary antibodies

Search for all "HSPA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat HSPA2

TA333713

More Views

  • TA333713

Product Description for HSPA2

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat HSPA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSPA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSP70-2, Heat shock-related 70 kDa protein 2
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P54652
Immunogen:
The immunogen for Anti-HSPA2 Antibody: synthetic peptide directed towards the middle region of human HSPA2. Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK.
GeneID:
3306
Application WB
Background HSPA2 belongs to the heat shock protein 70 family.In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nontive conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HSPA2 (3 products)

Catalog No. Species Pres. Purity   Source  

HSPA2

HSPA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HSPA2

HSPA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HSPA2

HSPA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HSPA2 (2 products)

Catalog No. Species Pres. Purity   Source  

HSPA2 293T Cell Transient Overexpression Lysate(Denatured)

HSPA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSPA2 Lysate

Western Blot: HSPA2 Lysate [NBL1-11751] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSPA2
  Novus Biologicals Inc.
  • LinkedIn