TA333716 FANCE antibody

Rabbit Polyclonal Anti-FANCE Antibody

See related secondary antibodies

Search for all "FANCE"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit FANCE

Product Description for FANCE

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit FANCE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FANCE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FACE, Fanconi anemia group E protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB96
Immunogen:
The immunogen for Anti-FANCE Antibody: synthetic peptide directed towards the middle region of human FANCE. Synthetic peptide located within the following region: SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH.
GeneID:
2178
Application WB
Background The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to D crosslinking agents, increased chromosomal breakage, and defective D repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex.The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to D crosslinking agents, increased chromosomal breakage, and defective D repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group E. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FANCE (2 products)

Catalog No. Species Pres. Purity   Source  

FANCE

FANCE Human Purified
  Abnova Taiwan Corp.

FANCE

FANCE Human Purified
  Abnova Taiwan Corp.

Positive controls for FANCE (1 products)

Catalog No. Species Pres. Purity   Source  

FANCE 293T Cell Transient Overexpression Lysate(Denatured)

FANCE 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn