TA333747 SLC37A1 antibody

Rabbit Polyclonal Anti-SLC37A1 Antibody

See related secondary antibodies

Search for all "SLC37A1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC37A1

Product Description for SLC37A1

Rabbit anti Human SLC37A1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC37A1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-3-P permease, G-3-P transporter, G3P permease, G3P transporter, G3PP, Glycerol-3-phosphate permease, Glycerol-3-phosphate transporter, Solute carrier family 37 member 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57057
Immunogen:
The immunogen for Anti-SLC37A1 Antibody: synthetic peptide directed towards the middle region of human SLC37A1. Synthetic peptide located within the following region: LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD.
GeneID:
54020
Application WB
Background SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC37A1 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC37A1 overexpression lysate

SLC37A1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn