TA333751 SLC22A15 antibody

Rabbit Polyclonal Anti-SLC22A15 Antibody

See related secondary antibodies

Search for all "SLC22A15"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC22A15

Product Description for SLC22A15

Rabbit anti Human SLC22A15.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC22A15

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLIPT1, Flipt-1, Fly-like putative transporter 1, Solute carrier family 22 member 15
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZD6
Immunogen:
The immunogen for Anti-SLC22A15 Antibody: synthetic peptide directed towards the middle region of human SLC22A15. Synthetic peptide located within the following region: NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK.
GeneID:
55356
Application WB
Background Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM, Apr 2004]. ##Evidence-Data-START## Transcript exon combition :: BC026358.1, BC070033.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn