TA333778 Claudin-18 / CLDN18 antibody

Rabbit Polyclonal Anti-CLDN18 Antibody

See related secondary antibodies

Search for all "Claudin-18 / CLDN18"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Claudin-18 / CLDN18

Product Description for Claudin-18 / CLDN18

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Claudin-18 / CLDN18.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Claudin-18 / CLDN18

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRO1572, UNQ778
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56856
Immunogen:
The immunogen for Anti-CLDN18 Antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY.
GeneID:
51208
Application WB
Background CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-18 / CLDN18 (4 products)

Catalog No. Species Pres. Purity   Source  

Claudin-18 / CLDN18

Claudin-18 / CLDN18 Human Purified
  Abnova Taiwan Corp.

Claudin-18 / CLDN18

Claudin-18 / CLDN18 Human Purified
  Abnova Taiwan Corp.

Claudin-18 / CLDN18

Claudin-18 / CLDN18 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Claudin-18 / CLDN18

Claudin-18 / CLDN18 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn