TA333782 HSPB11 antibody

Rabbit Polyclonal Anti-HSPB11 Antibody

See related secondary antibodies

Search for all "HSPB11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HSPB11

Product Description for HSPB11

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HSPB11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSPB11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf41, HSPC034, Heat shock protein beta-11
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y547
Immunogen:
The immunogen for Anti-HSPB11 Antibody is: synthetic peptide directed towards the middle region of Human HSPB11. Synthetic peptide located within the following region: IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH.
GeneID:
51668
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HSPB11 (5 products)

Catalog No. Species Pres. Purity   Source  

HSPB11

HSPB11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HSPB11

HSPB11 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

HSPB11 (1-144, His-tag)

HSPB11 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

HSPB11 (1-144, His-tag)

HSPB11 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

HSPB11

HSPB11 Human
  Abnova Taiwan Corp.

Positive controls for HSPB11 (2 products)

Catalog No. Species Pres. Purity   Source  

HSPB11 Lysate

Western Blot: HSPB11 Lysate [NBL1-11758] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSPB11
  Novus Biologicals Inc.

HSPB11 overexpression lysate

HSPB11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn