TA333785 TMBIM4 antibody

Rabbit Polyclonal Anti-TMBIM4 Antibody

See related secondary antibodies

Search for all "TMBIM4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMBIM4

Product Description for TMBIM4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMBIM4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMBIM4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GAAP, Golgi anti-apoptotic protein, LFG4, Protein S1R, Protein lifeguard 4, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HC24
Immunogen:
The immunogen for Anti-TMBIM4 Antibody is: synthetic peptide directed towards the middle region of Human TMBIM4. Synthetic peptide located within the following region: LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL.
GeneID:
51643
Application WB
Background TMBIM4 is an anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. It can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMBIM4 (1 products)

Catalog No. Species Pres. Purity   Source  

TMBIM4 overexpression lysate

TMBIM4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn