discontinued

TA333801 C1orf144 antibody

Rabbit Polyclonal Anti-SZRD1 Antibody

See related secondary antibodies

Search for all "C1orf144"

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat C1orf144

TA333801

More Views

  • TA333801
  • TA333801

Product Description for C1orf144

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat C1orf144.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C1orf144

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative MAPK-activating protein PM18/PM20/PM22, UPF0485 protein C1orf144
Presentation Purified
Reactivity Bov, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z422
Immunogen:
The immunogen for Anti-SZRD1 Antibody: synthetic peptide directed towards the N terminal of human SZRD1. Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN.
GeneID:
26099
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf144 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf144 (transcript variant 1)

C1orf144 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C1orf144 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf144 Lysate

Western Blot: C1orf144 Lysate [NBL1-08298] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf144 Protein
  Novus Biologicals Inc.
  • LinkedIn