TA333809 Ankycorbin / RAI14 antibody

Rabbit Polyclonal Anti-RAI14 Antibody

See related secondary antibodies

Search for all "Ankycorbin / RAI14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Ankycorbin / RAI14

Product Description for Ankycorbin / RAI14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Ankycorbin / RAI14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Ankycorbin / RAI14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat and coiled-coil structure-containing protein, KIAA1334, NORPEG, Novel retinal pigment epithelial cell protein, Retinoic acid-induced protein 14
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0K7
Immunogen:
The immunogen for Anti-RAI14 Antibody: synthetic peptide directed towards the middle region of human RAI14. Synthetic peptide located within the following region: LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED.
GeneID:
26064
Application WB
Background RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Ankycorbin / RAI14 (2 products)

Catalog No. Species Pres. Purity   Source  

Ankycorbin / RAI14 (transcript variant 1)

Ankycorbin / RAI14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Ankycorbin / RAI14 (transcript variant 2)

Ankycorbin / RAI14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for Ankycorbin / RAI14 (1 products)

Catalog No. Species Pres. Purity   Source  

RAI14 overexpression lysate

RAI14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn