TA333832 C22orf9 antibody

Rabbit Polyclonal Anti-KIAA0930 Antibody

See related secondary antibodies

Search for all "C22orf9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C22orf9

Product Description for C22orf9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C22orf9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C22orf9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0930, Uncharacterized protein C22orf9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ICG6
Immunogen:
The immunogen for Anti-KIAA0930 Antibody: synthetic peptide directed towards the middle region of human KIAA0930. Synthetic peptide located within the following region: ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF.
GeneID:
23313
Application WB
Background The function of KIAA0930 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C22orf9 (1 products)

Catalog No. Species Pres. Purity   Source  

C22orf9 (transcript variant 1)

C22orf9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C22orf9 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA0930 overexpression lysate

KIAA0930 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn