TA333839 FBXO28 antibody

Rabbit Polyclonal Anti-FBXO28 Antibody

See related secondary antibodies

Search for all "FBXO28"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FBXO28

Product Description for FBXO28

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FBXO28.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXO28

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box only protein 28, KIAA0483
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVF7
Immunogen:
The immunogen for Anti-FBXO28 Antibody: synthetic peptide directed towards the middle region of human FBXO28. Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK.
GeneID:
23219
Application WB
Background Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXO28 (7 products)

Catalog No. Species Pres. Purity   Source  

FBXO28 (full length, N-term HIS tag, transcript variant 1)

FBXO28 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

FBXO28

FBXO28 Human
  Abnova Taiwan Corp.

FBXO28

FBXO28 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXO28

FBXO28 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXO28

FBXO28 Human
  Abnova Taiwan Corp.

FBXO28

FBXO28 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FBXO28

FBXO28 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FBXO28 (2 products)

Catalog No. Species Pres. Purity   Source  

FBXO28 293T Cell Transient Overexpression Lysate(Denatured)

FBXO28 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FBXO28 Lysate

Western Blot: FBXO28 Lysate [NBL1-10628] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FBXO28
  Novus Biologicals Inc.
  • LinkedIn