TA333870 XCT / SLC7A11 antibody

Rabbit Polyclonal Anti-SLC7A11 Antibody

See related secondary antibodies

Search for all "XCT / SLC7A11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human XCT / SLC7A11

Product Description for XCT / SLC7A11

Rabbit anti Human XCT / SLC7A11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for XCT / SLC7A11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Amino acid transport system xc, CCBR1, Calcium channel blocker resistance protein CCBR1, Cystine/glutamate transporter, Solute carrier family 7 member 11
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPY5
Immunogen:
The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK.
GeneID:
23657
Application WB
Background SLC7A11 is a member of a heteromeric (+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, desigted system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for XCT / SLC7A11 (2 products)

Catalog No. Species Pres. Purity   Source  

XCT / SLC7A11

XCT / SLC7A11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

XCT / SLC7A11

XCT / SLC7A11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for XCT / SLC7A11 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC7A11 overexpression lysate

SLC7A11 overexpression lysate
  OriGene Technologies, Inc.

xCT Lysate

Western Blot: xCT Lysate [NBL1-16185] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC7A11
  Novus Biologicals Inc.
  • LinkedIn