TA333875 SLC25A24 / SCAMC1 antibody

Rabbit Polyclonal Anti-SLC25A24 Antibody

See related secondary antibodies

Search for all "SLC25A24 / SCAMC1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC25A24 / SCAMC1

Product Description for SLC25A24 / SCAMC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC25A24 / SCAMC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A24 / SCAMC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms APC1, Calcium-binding mitochondrial carrier protein SCaMC-1, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC-1, Small calcium-binding mitochondrial carrier protein 1, Solute carrier family 25 member 24
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NUK1
Immunogen:
The immunogen for Anti-SLC25A24 Antibody: synthetic peptide directed towards the middle region of human SLC25A24. Synthetic peptide located within the following region: FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA.
GeneID:
29957
Application WB
Background SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC25A24 / SCAMC1 (4 products)

Catalog No. Species Pres. Purity   Source  

SLC25A24 / SCAMC1

SLC25A24 / SCAMC1 Human Purified
  Abnova Taiwan Corp.

SLC25A24 / SCAMC1

SLC25A24 / SCAMC1 Human Purified
  Abnova Taiwan Corp.

SLC25A24 / SCAMC1

SLC25A24 / SCAMC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SLC25A24 / SCAMC1

SLC25A24 / SCAMC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SLC25A24 / SCAMC1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC25A24 293T Cell Transient Overexpression Lysate(Denatured)

SLC25A24 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SLC25A24 overexpression lysate

SLC25A24 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn