TA333877 ANKRD11 antibody

Rabbit Polyclonal Anti-ANKRD11 Antibody

See related secondary antibodies

Search for all "ANKRD11"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ANKRD11

TA333877

More Views

  • TA333877

Product Description for ANKRD11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ANKRD11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ANKRD11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ANCO1, Ankyrin repeat domain-containing protein 11, Ankyrin repeat-containing cofactor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UB99
Immunogen:
The immunogen for Anti-ANKRD11 Antibody: synthetic peptide directed towards the N terminal of human ANKRD11. Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR.
GeneID:
29123
Application WB
IHC
Background ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as sopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn