TA333880 LSM5 antibody

Rabbit Polyclonal Anti-LSM5 Antibody

See related secondary antibodies

Search for all "LSM5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish LSM5

Product Description for LSM5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish LSM5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LSM5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms U6 snRNA-associated Sm-like protein LSm5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4Y9
Immunogen:
The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV.
GeneID:
23658
Application WB
Background Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mR splicing.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LSM5 (6 products)

Catalog No. Species Pres. Purity   Source  

LSM5 (transcript variant 1)

LSM5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LSM5 (1-91, His-tag)

LSM5 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

LSM5 (1-91, His-tag)

LSM5 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

LSM5

LSM5 Human in vitro transl.
  Abnova Taiwan Corp.

LSM5

LSM5 Human in vitro transl.
  Abnova Taiwan Corp.

LSM5

LSM5 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LSM5 (1 products)

Catalog No. Species Pres. Purity   Source  

LSM5 Lysate

Western Blot: LSM5 Lysate [NBL1-12728] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LSM5.
  Novus Biologicals Inc.
  • LinkedIn