TA333885 USP12 antibody

Rabbit Polyclonal Anti-Usp12 Antibody

See related secondary antibodies

Search for all "USP12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse USP12

Product Description for USP12

Rabbit anti Human, Mouse USP12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for USP12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deubiquitinating enzyme 12, UBH1, USP12L1, Ubiquitin carboxyl-terminal hydrolase 12, Ubiquitin thioesterase 12, Ubiquitin-hydrolyzing enzyme 1, Ubiquitin-specific-processing protease 12
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9D9M2
Immunogen:
The immunogen for Anti-Usp12 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Usp12. Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD.
GeneID:
22217
Application WB
Background Usp12 is a deubiquititing enzyme. It has almost no deubiquititing activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitition of monoubiquitited FANCD2.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn