discontinued

TA333888 SUPT6H antibody

Rabbit Polyclonal Anti-SUPT6H Antibody

See related secondary antibodies

Search for all "SUPT6H"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Mouse, Rabbit, Rat SUPT6H

TA333888

Product Description for SUPT6H

Rabbit anti Bovine, Canine, Equine, Mouse, Rabbit, Rat SUPT6H.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SUPT6H

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0162, SPT6, SPT6H, Suppressor of Ty 6 homolog, Tat-CT2 protein, Tat-cotransactivator 2 protein, Transcription elongation factor SPT6
Presentation Purified
Reactivity Bov, Can, Eq, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7KZ85
Immunogen:
The immunogen for Anti-SUPT6H Antibody: synthetic peptide directed towards the N terminal of human SUPT6H. Synthetic peptide located within the following region: EGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR.
GeneID:
6830
Application WB
Background SUPT6H may be functiolly alogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintence of chromatin structure. Spt6 may also participates in the regulation of transcription by R polymerase II (RPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn