TA333908 SHOX2 / SHOT antibody

Rabbit Polyclonal Anti-SHOX2 Antibody

See related secondary antibodies

Search for all "SHOX2 / SHOT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish SHOX2 / SHOT

TA333908

More Views

  • TA333908

Product Description for SHOX2 / SHOT

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish SHOX2 / SHOT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SHOX2 / SHOT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Og12X, OG12X, Paired-related homeobox protein SHOT, Short stature homeobox protein 2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60902
Immunogen:
The immunogen for Anti-SHOX2 Antibody: synthetic peptide directed towards the N terminal of human SHOX2. Synthetic peptide located within the following region: EELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDR.
GeneID:
6474
Application WB
Background SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a D binding domain. Homeo box genes have been characterized extensively as transcriptiol regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a D binding domain. Homeo box genes have been characterized extensively as transcriptiol regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Altertive splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SHOX2 / SHOT (6 products)

Catalog No. Species Pres. Purity   Source  

SHOX2 / SHOT (transcript variant 3)

SHOX2 / SHOT Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SHOX2 / SHOT (full length, N-term HIS tag, transcript variant 2)

SHOX2 / SHOT Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SHOX2 / SHOT

SHOX2 / SHOT Human Purified
  Abnova Taiwan Corp.

SHOX2 / SHOT

SHOX2 / SHOT Human Purified
  Abnova Taiwan Corp.

SHOX2 / SHOT

SHOX2 / SHOT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SHOX2 / SHOT

SHOX2 / SHOT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SHOX2 / SHOT (3 products)

Catalog No. Species Pres. Purity   Source  

SHOX2 293T Cell Transient Overexpression Lysate(Denatured)

SHOX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SHOX2 overexpression lysate

SHOX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SHOX2 overexpression lysate

SHOX2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn