TA333913 BTG2 antibody

Rabbit Polyclonal Anti-BTG2 Antibody

See related secondary antibodies

Search for all "BTG2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep BTG2

Product Description for BTG2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep BTG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTG2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTG family member 2, NGF-inducible anti-proliferative protein PC3, PC3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78543
Immunogen:
The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV.
GeneID:
7832
Application WB
Background BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTG2 (5 products)

Catalog No. Species Pres. Purity   Source  

BTG2 (full length, N-term HIS tag)

BTG2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

BTG2

BTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BTG2

BTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BTG2

BTG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BTG2

BTG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BTG2 (2 products)

Catalog No. Species Pres. Purity   Source  

BTG2 Lysate

Western Blot: BTG2 Lysate [NBL1-08048] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BTG2 Protein
  Novus Biologicals Inc.

BTG2 overexpression lysate

BTG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn