TA333931 SLC35B1 / UGTREL1 antibody

Rabbit Polyclonal Anti-SLC35B1 Antibody

See related secondary antibodies

Search for all "SLC35B1 / UGTREL1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC35B1 / UGTREL1

Product Description for SLC35B1 / UGTREL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC35B1 / UGTREL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35B1 / UGTREL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Solute carrier family 35 member B1, UDP-galactose transporter-related protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78383
Immunogen:
The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT.
GeneID:
10237
Application WB
Background SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC35B1 / UGTREL1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC35B1 / UGTREL1

SLC35B1 / UGTREL1 Human Purified
  Abnova Taiwan Corp.

SLC35B1 / UGTREL1

SLC35B1 / UGTREL1 Human Purified
  Abnova Taiwan Corp.

Positive controls for SLC35B1 / UGTREL1 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC35B1 overexpression lysate

SLC35B1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn