TA333975 ZNF235 antibody

Rabbit Polyclonal Anti-ZNF235 Antibody

See related secondary antibodies

Search for all "ZNF235"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat ZNF235

Product Description for ZNF235

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat ZNF235.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF235

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HZF6, ZFP93, ZNF270, Zfp-93, Zinc finger protein 235, Zinc finger protein 270, Zinc finger protein 93 homolog
Presentation Purified
Reactivity GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14590
Immunogen:
The immunogen for Anti-ZNF235 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF235. Synthetic peptide located within the following region: FRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSGDRNQNEMATL.
GeneID:
9310
Application WB
Background This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the Kruppel family of zinc finger proteins, and contains Kruppel-associated box (KRAB) A and B domains and 15 tandemly arrayed C2H2-type zinc fingers. It is an ortholog of the mouse Zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn