TA333986 SLC25A14 / BMCP1 antibody

Rabbit Polyclonal Anti-SLC25A14 Antibody

See related secondary antibodies

Search for all "SLC25A14 / BMCP1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish SLC25A14 / BMCP1

Product Description for SLC25A14 / BMCP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish SLC25A14 / BMCP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A14 / BMCP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BMCP-1, Brain mitochondrial carrier protein 1, Mitochondrial uncoupling protein 5, Solute carrier family 25 member 14, UCP 5, UCP-5, UCP5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95258
Immunogen:
The immunogen for Anti-SLC25A14 Antibody: synthetic peptide directed towards the N terminal of human SLC25A14. Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV.
GeneID:
9016
Application WB
Background Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-termil hydrophobic domain that is not present in other UCPs.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC25A14 / BMCP1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC25A14 / BMCP1

SLC25A14 / BMCP1 Human Purified
  Abnova Taiwan Corp.

SLC25A14 / BMCP1

SLC25A14 / BMCP1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn